BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0112 (713 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 25 0.71 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 25 0.94 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 5.0 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.6 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 25.0 bits (52), Expect = 0.71 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 250 VHVAACMITESHNVIDEQSVLRRLNALTLNGA 345 ++ ++C I + DEQS + + + T NGA Sbjct: 153 IYKSSCEINVEYFPFDEQSCIMKFGSWTYNGA 184 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.6 bits (51), Expect = 0.94 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -1 Query: 389 SNGPTPQHEQQLPSEAPFKVKALRRRKTLCSSMTLCDSVII 267 + GP HE Q P + L T S MT S I+ Sbjct: 301 TGGPRKSHESQCPMLQKLEKPVLSSSTTTTSPMTSTKSTIV 341 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 404 CCARVSNGPTPQHEQQL 354 C AR GPTP+ +++L Sbjct: 170 CDARKKKGPTPRQQEEL 186 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.2 bits (45), Expect = 5.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 384 IRDPCAANGSL*ASLAHF*LEEETIWKISIIHW 482 + DP A S LA +E I K+S I+W Sbjct: 347 LADPSFAQFSQEIGLASLGASDEEIEKLSTIYW 379 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/31 (22%), Positives = 18/31 (58%) Frame = +1 Query: 250 VHVAACMITESHNVIDEQSVLRRLNALTLNG 342 ++ ++C I ++ D+Q+ + + + T NG Sbjct: 146 IYQSSCTIDVTYFPFDQQTCIMKFGSWTFNG 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,605 Number of Sequences: 438 Number of extensions: 3782 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -