BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0110 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 24 3.9 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 9.0 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 24.2 bits (50), Expect = 3.9 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -1 Query: 261 QK*EAFRSSELFVLLLQLFQDNNTSFIPYLIHVMFTLSRLPNYIQ 127 Q+ EAFR ++LLQ+ Q N F P L V L + ++++ Sbjct: 321 QRLEAFR-----MMLLQINQRNKHDFAPRLTRVAKELDKCESFVK 360 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 260 KNKKRFDHLSYLYYYCNY 207 ++KKR+ + Y+YY Y Sbjct: 352 RHKKRWSQVMYMYYLLGY 369 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,310 Number of Sequences: 2352 Number of extensions: 10147 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -