BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0110 (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41996-7|AAA83476.1| 298|Caenorhabditis elegans Hypothetical pr... 28 5.4 AF068709-12|AAO26013.1| 304|Caenorhabditis elegans Serpentine r... 27 9.5 >U41996-7|AAA83476.1| 298|Caenorhabditis elegans Hypothetical protein F38E1.10 protein. Length = 298 Score = 28.3 bits (60), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 127 D*YLLNFSKLIKITIKYNLHC 65 D Y++N + ++ + KYNLHC Sbjct: 238 DQYIINGNDILDVAAKYNLHC 258 >AF068709-12|AAO26013.1| 304|Caenorhabditis elegans Serpentine receptor, class g (gamma)protein 57 protein. Length = 304 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 491 VDYVMKNNKLIKFEYPAIKKQTLMNTVAILVSYFI 387 V+ + N L KF YP + Q + T + V YFI Sbjct: 169 VEVKIINGTLTKFRYPDVMDQAINVTAVLNVVYFI 203 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,937,535 Number of Sequences: 27780 Number of extensions: 239845 Number of successful extensions: 409 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -