SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0110
         (687 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    24   1.6  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    23   3.6  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    22   6.3  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    22   6.3  

>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 23.8 bits (49), Expect = 1.6
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -1

Query: 441 HKKANFNEYSCYISKLFY 388
           +K +N+N Y+ Y  KL+Y
Sbjct: 89  YKYSNYNNYNNYNKKLYY 106


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 22.6 bits (46), Expect = 3.6
 Identities = 8/42 (19%), Positives = 20/42 (47%)
 Frame = -1

Query: 240 SSELFVLLLQLFQDNNTSFIPYLIHVMFTLSRLPNYIQINIY 115
           +S  F+L+  + + NN     Y+   +  + + P  + + I+
Sbjct: 462 NSNQFILMTTVNEGNNNMAATYMNECLLNIQKSPRTLTLGIF 503


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 444 CHKKANFNEYSC 409
           C+ K N  EYSC
Sbjct: 219 CNSKTNTGEYSC 230


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 444 CHKKANFNEYSC 409
           C+ K N  EYSC
Sbjct: 219 CNSKTNTGEYSC 230


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,404
Number of Sequences: 438
Number of extensions: 3040
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20952180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -