BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0108 (746 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025469-5|AAG00029.1| 2054|Caenorhabditis elegans Hypothetical ... 30 2.0 U80027-11|AAC48117.2| 106|Caenorhabditis elegans Hypothetical p... 28 8.1 >AF025469-5|AAG00029.1| 2054|Caenorhabditis elegans Hypothetical protein W09B6.1a protein. Length = 2054 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 271 VAGDVAHVLAERCTYCGAICRVRIVGGFTKTITHEIIK 158 +AG+ A AE TYC R +G +T + H I++ Sbjct: 1558 IAGETARAYAEVPTYCYVTGRSVGIGAYTARLAHRIVQ 1595 >U80027-11|AAC48117.2| 106|Caenorhabditis elegans Hypothetical protein T28A11.6 protein. Length = 106 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 439 SSPQLVGMTQLGHLSNAHSNSDHIKSTKSSFNSKIT-TLSTFSILI 573 +SP + G++ + +N H + HI TK++ N I + TFS+ + Sbjct: 45 ASPIVFGVSGVVGKNNEHKHGTHINITKTATNPLIVHNVGTFSVSV 90 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,683,104 Number of Sequences: 27780 Number of extensions: 280468 Number of successful extensions: 726 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -