BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0103 (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 29 0.93 SPBC16E9.13 |ksp1|ppk20|serine/threonine protein kinase Ksp1 |Sc... 26 6.6 SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharom... 25 8.7 >SPCC1919.12c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 843 Score = 28.7 bits (61), Expect = 0.93 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 238 YSNHSTYNTIVNCKLT*YYDSVHSGTIT*YILFLLHI 128 Y+ + T +V ++T YD +H G I Y F+ H+ Sbjct: 785 YTLNLTITEVVKAEVTCLYDDIHEGIIPAYNTFVEHL 821 >SPBC16E9.13 |ksp1|ppk20|serine/threonine protein kinase Ksp1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 25.8 bits (54), Expect = 6.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 200 QTNLIL*LSTFRHDNIIHFIST 135 + N++ LS RH NIIHF+ + Sbjct: 55 EVNILRQLSRSRHRNIIHFVES 76 >SPBC713.04c |||U3 snoRNP-associated protein Utp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 854 Score = 25.4 bits (53), Expect = 8.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 413 ISKLKRHIEINLYFCLDKLHLKTLN 339 +S+L + E L F LDK+HL+ N Sbjct: 828 LSQLSSNNEFQLSFLLDKMHLRLEN 852 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,270,555 Number of Sequences: 5004 Number of extensions: 35228 Number of successful extensions: 74 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -