BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0102 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 25 1.7 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 25 2.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.9 CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein ... 24 3.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.8 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 3.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.8 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 5.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.1 DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 23 6.7 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 23 6.7 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 23 6.7 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 23 6.7 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 23 8.9 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 8.9 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 23 8.9 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 23 8.9 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 8.9 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 8.9 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 83 PYVKGETYSSVRGVFNQCLITCAVLILAA 169 PYV GET+ +RG+ + VL + A Sbjct: 111 PYVFGETFCVLRGIAAEMSANATVLTITA 139 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 326 EAIGRRRTLQSCTVPLVVGWIIIGTAS 406 E GRR+ Q C +++ +I+G A+ Sbjct: 568 EQTGRRKNTQGCKDQVIIDAVIVGQAA 594 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 111 EEYVSPLTYGGNVAVELI 58 E+Y SP Y GN V LI Sbjct: 2663 EQYASPYLYAGNSPVSLI 2680 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 111 EEYVSPLTYGGNVAVELI 58 E+Y SP Y GN V LI Sbjct: 2664 EQYASPYLYAGNSPVSLI 2681 >CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein protein. Length = 207 Score = 24.2 bits (50), Expect = 3.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 3 RKNQINRTNTKPYRVSCAVSAQRPHYHHTSKEKHTL 110 RK +NR+++K A++ +RP + S K T+ Sbjct: 5 RKQVLNRSSSKSNFTKSAINRKRPEKSNGSTVKKTI 40 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 3.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 111 EEYVSPLTYGGNVAVELI 58 E+Y SP Y GN V LI Sbjct: 2703 EQYPSPYVYAGNSPVSLI 2720 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 111 EEYVSPLTYGGNVAVELI 58 E+Y SP Y GN V LI Sbjct: 2713 EQYPSPYVYAGNSPVSLI 2730 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/35 (25%), Positives = 20/35 (57%) Frame = +2 Query: 356 SCTVPLVVGWIIIGTASHHALLLLGRIVCGFAVGL 460 +C P++ ++GTA+ + + + +V GF G+ Sbjct: 534 ACLSPIITFGGLLGTATGNNIAAMESLVSGFVCGI 568 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.2 bits (50), Expect = 3.8 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 6/69 (8%) Frame = +1 Query: 31 RSPTEFPAQYQLNGHIT---TIRQRRNILFRSGCIQSVPHNMCSVDPCRR---CGSSYRF 192 R P EF Q + ++ + RQ+ + G I PH CR+ C + RF Sbjct: 261 RQPQEFQQQQRQPQYLQPQQSQRQQEELTCPPGVIGLRPHPT----DCRKFLNCNNGARF 316 Query: 193 LSDCSTTTA 219 + DC TA Sbjct: 317 VQDCGPGTA 325 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 348 VRRRPMASITGPDTIEPRGVAAEWI 274 +R+R M G + ++ GVA EW+ Sbjct: 516 MRKRLMVKFKGEEGLDYGGVAREWL 540 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.1 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 397 SYYDP-PNDQRDGAGL*RPPPPDG 329 SY P P+ +G+G +PP P+G Sbjct: 1397 SYQHPHPHHHHNGSGRSKPPGPEG 1420 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 23.4 bits (48), Expect = 6.7 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -2 Query: 318 GPDTIEPRGVAAEWILAIQEPIS-SSVLIELFSRCSCGRAIAEKP 187 G T P + WIL +EPI S +ELF C A E P Sbjct: 198 GSLTTPPCSESVTWIL-FKEPIEVSHEQLELFREMRCYDAAEECP 241 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 6.7 Identities = 19/85 (22%), Positives = 36/85 (42%), Gaps = 5/85 (5%) Frame = +2 Query: 416 LLLLGRIVCGFAVGLMAAPSQVYLGEISEPRLRGLLIGTPFVAYSLGVLYVYTLGGP--- 586 LL+L + G VG+ V + + + +G V Y +G++Y T GG Sbjct: 424 LLMLFVLGIGSNVGMATTIMTVIRDRFPQLQPALVAVGIAIVGYGIGIIYT-TPGGQYVL 482 Query: 587 --LSWRSVAYLSTVLPILAFIALCF 655 L + ++++ VL + A + Sbjct: 483 DFLDFYGASFVALVLAVFEMFAFAW 507 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/38 (23%), Positives = 17/38 (44%) Frame = +2 Query: 29 YEALQSFLRSISSTATLPPYVKGETYSSVRGVFNQCLI 142 YE Q + + + T P YV+ + + + CL+ Sbjct: 128 YETFQCYFQEFGNLVTCPQYVRSTKLQATQAALD-CLV 164 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.4 bits (48), Expect = 6.7 Identities = 19/85 (22%), Positives = 36/85 (42%), Gaps = 5/85 (5%) Frame = +2 Query: 416 LLLLGRIVCGFAVGLMAAPSQVYLGEISEPRLRGLLIGTPFVAYSLGVLYVYTLGGP--- 586 LL+L + G VG+ V + + + +G V Y +G++Y T GG Sbjct: 424 LLMLFVLGIGSNVGMATTIMTVIRDRFPQLQPALVAVGIAIVGYGIGIIYT-TPGGQYVL 482 Query: 587 --LSWRSVAYLSTVLPILAFIALCF 655 L + ++++ VL + A + Sbjct: 483 DFLDFYGASFVALVLAVFEMFAFAW 507 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 542 AYSLGVLYVYTL 577 AYSLGV Y YTL Sbjct: 370 AYSLGVPYSYTL 381 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 326 PSPDLTPSSREG*LPS 279 P+ +LT SSR G LPS Sbjct: 64 PAKELTDSSRSGGLPS 79 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/42 (26%), Positives = 16/42 (38%) Frame = +2 Query: 29 YEALQSFLRSISSTATLPPYVKGETYSSVRGVFNQCLITCAV 154 YE Q + R + T P YV + + + CL V Sbjct: 128 YETFQCYFREFGNLVTCPQYVPATKLQATQAALD-CLTVLRV 168 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 542 AYSLGVLYVYTL 577 AYSLGV Y YTL Sbjct: 370 AYSLGVPYSYTL 381 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 8.9 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +2 Query: 563 YVYTLGGPLSW 595 +++ LGGP+SW Sbjct: 805 FIFHLGGPISW 815 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = +1 Query: 85 IRQRRNILFRSGCIQSVPHNMCSVDPCRRCGSSYRFLSDC 204 IR R +L+ ++ PH C RC DC Sbjct: 380 IRLRLKVLYTMCAVKEAPHTPIEKLRCYRCLERGHVSRDC 419 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 846,930 Number of Sequences: 2352 Number of extensions: 20032 Number of successful extensions: 63 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -