BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0101 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0557 + 4394754-4396040 28 6.0 09_02_0338 + 7426999-7428322,7428390-7428646 28 7.9 05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 28 7.9 >11_01_0557 + 4394754-4396040 Length = 428 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 509 PLSRSPTGSAFTVSVSLGF 453 PL R+P+G+ F SVSLGF Sbjct: 319 PLFRTPSGAIFCSSVSLGF 337 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = +1 Query: 280 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 420 LM C L HR P L + L A L+AI KSYY + Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >05_04_0118 - 18162934-18162982,18163246-18163357,18163583-18163622 Length = 66 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 6/42 (14%) Frame = -3 Query: 266 RFQLSGNSGRKHSRCCTSILRKFSGR------QHCVTVDCCC 159 R +G+K RCC S R+ + R + C+ CCC Sbjct: 17 RLDSEQQAGKKKGRCCGSSCRRSTKRGETSFIEGCIAALCCC 58 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,293,073 Number of Sequences: 37544 Number of extensions: 346350 Number of successful extensions: 781 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -