Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0101
         (679 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB051470-1|BAB21774.1|  832|Homo sapiens KIAA1683 protein protein.     31   5.0  

>AB051470-1|BAB21774.1|  832|Homo sapiens KIAA1683 protein protein.
          Length = 832

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +1

Query: 442 SSTVKPNETDTVN---AEPVGDRESGQKYGLLSLTSSHRQPISSPAMYRPSLNAMSPLAF 612
           SS   P++T  V+   A+P      G+ Y   +L SS  +P  +P+++ PS+     L+ 
Sbjct: 623 SSLAYPSQTTAVSPRQAQPSVASSPGKTYSSCTLASSLAEPAIAPSLFPPSVAHTEALSL 682

Query: 613 SAFP 624
           +  P
Sbjct: 683 AQSP 686


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,974,377
Number of Sequences: 237096
Number of extensions: 1884678
Number of successful extensions: 7245
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7148
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7245
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7671262118
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)