BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0097 (734 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00065-1|AAK68287.1| 400|Caenorhabditis elegans Hypothetical pr... 29 3.4 Z81506-3|CAB04130.1| 197|Caenorhabditis elegans Hypothetical pr... 28 7.9 >U00065-1|AAK68287.1| 400|Caenorhabditis elegans Hypothetical protein D1044.7 protein. Length = 400 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 587 LNKNNNFVFPLMCTPSDGFLC 649 L NNNF PL CTP D C Sbjct: 26 LTSNNNFNQPLTCTPQDPCSC 46 >Z81506-3|CAB04130.1| 197|Caenorhabditis elegans Hypothetical protein F16H6.4 protein. Length = 197 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = -2 Query: 715 DFVVPQSINKRPKLLYKINLKQTKESVRRGTHQRKNKIVIF 593 +F + QS K ++ KI+ ++ + ++ G+H +KN + IF Sbjct: 61 NFKMEQSYEKVDEIPEKIDAERIRYAIHLGSHSQKNVLQIF 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,370,178 Number of Sequences: 27780 Number of extensions: 282578 Number of successful extensions: 705 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -