BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0096 (632 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9NYP3 Cluster: Protein downstream neighbor of Son; n=2... 34 2.5 UniRef50_Q9Y4B6 Cluster: Protein VPRBP; n=26; Fungi/Metazoa grou... 33 7.5 >UniRef50_Q9NYP3 Cluster: Protein downstream neighbor of Son; n=27; Tetrapoda|Rep: Protein downstream neighbor of Son - Homo sapiens (Human) Length = 566 Score = 34.3 bits (75), Expect = 2.5 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 90 TGPILPNDFHFQTIILSSLSQFYFSLILFIHTP 188 TGPI+P+ H T++L S FS +L+ H P Sbjct: 473 TGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEP 505 >UniRef50_Q9Y4B6 Cluster: Protein VPRBP; n=26; Fungi/Metazoa group|Rep: Protein VPRBP - Homo sapiens (Human) Length = 1507 Score = 32.7 bits (71), Expect = 7.5 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -1 Query: 464 TTRITCICLLIYYQIML*IKIE--KQNLLRKEGTCVFH----YYSCSISH 333 T + TC+ L Y++ L IK+E KQ+L R EG + H Y +CS +H Sbjct: 516 TGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTH 565 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,134,338 Number of Sequences: 1657284 Number of extensions: 9870621 Number of successful extensions: 17453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17453 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46881492319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -