BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0096 (632 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC048266-1|AAH48266.1| 566|Homo sapiens downstream neighbor of ... 34 0.36 AK074964-1|BAC11320.1| 566|Homo sapiens protein ( Homo sapiens ... 34 0.36 AK001274-1|BAA91594.1| 326|Homo sapiens protein ( Homo sapiens ... 34 0.36 AF232673-1|AAF72947.1| 462|Homo sapiens B17 long form protein. 34 0.36 BC110371-1|AAI10372.1| 1506|Homo sapiens VPRBP protein protein. 33 1.1 AF061935-1|AAG27134.1| 1401|Homo sapiens HIV-1 Vpr-binding prote... 33 1.1 AB018343-1|BAA34520.2| 1521|Homo sapiens KIAA0800 protein protein. 33 1.1 >BC048266-1|AAH48266.1| 566|Homo sapiens downstream neighbor of SON protein. Length = 566 Score = 34.3 bits (75), Expect = 0.36 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 90 TGPILPNDFHFQTIILSSLSQFYFSLILFIHTP 188 TGPI+P+ H T++L S FS +L+ H P Sbjct: 473 TGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEP 505 >AK074964-1|BAC11320.1| 566|Homo sapiens protein ( Homo sapiens cDNA FLJ90483 fis, clone NT2RP3002983. ). Length = 566 Score = 34.3 bits (75), Expect = 0.36 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 90 TGPILPNDFHFQTIILSSLSQFYFSLILFIHTP 188 TGPI+P+ H T++L S FS +L+ H P Sbjct: 473 TGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEP 505 >AK001274-1|BAA91594.1| 326|Homo sapiens protein ( Homo sapiens cDNA FLJ10412 fis, clone NT2RP1000040. ). Length = 326 Score = 34.3 bits (75), Expect = 0.36 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 90 TGPILPNDFHFQTIILSSLSQFYFSLILFIHTP 188 TGPI+P+ H T++L S FS +L+ H P Sbjct: 233 TGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEP 265 >AF232673-1|AAF72947.1| 462|Homo sapiens B17 long form protein. Length = 462 Score = 34.3 bits (75), Expect = 0.36 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 90 TGPILPNDFHFQTIILSSLSQFYFSLILFIHTP 188 TGPI+P+ H T++L S FS +L+ H P Sbjct: 369 TGPIMPHSLHSLTMLLKSSQSGSFSAVLYPHEP 401 >BC110371-1|AAI10372.1| 1506|Homo sapiens VPRBP protein protein. Length = 1506 Score = 32.7 bits (71), Expect = 1.1 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -1 Query: 464 TTRITCICLLIYYQIML*IKIE--KQNLLRKEGTCVFH----YYSCSISH 333 T + TC+ L Y++ L IK+E KQ+L R EG + H Y +CS +H Sbjct: 515 TGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTH 564 >AF061935-1|AAG27134.1| 1401|Homo sapiens HIV-1 Vpr-binding protein protein. Length = 1401 Score = 32.7 bits (71), Expect = 1.1 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -1 Query: 464 TTRITCICLLIYYQIML*IKIE--KQNLLRKEGTCVFH----YYSCSISH 333 T + TC+ L Y++ L IK+E KQ+L R EG + H Y +CS +H Sbjct: 410 TGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTH 459 >AB018343-1|BAA34520.2| 1521|Homo sapiens KIAA0800 protein protein. Length = 1521 Score = 32.7 bits (71), Expect = 1.1 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = -1 Query: 464 TTRITCICLLIYYQIML*IKIE--KQNLLRKEGTCVFH----YYSCSISH 333 T + TC+ L Y++ L IK+E KQ+L R EG + H Y +CS +H Sbjct: 530 TGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTH 579 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,922,330 Number of Sequences: 237096 Number of extensions: 1404749 Number of successful extensions: 1858 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1858 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6916500330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -