BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0095 (319 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 26 1.6 SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|S... 25 3.7 SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomy... 24 4.8 SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Ma... 24 4.8 SPAC6F12.10c |ade3|min11|phosphoribosylformylglycinamidine synth... 24 6.4 SPAC1D4.04 |cct2||chaperonin-containing T-complex beta subunit C... 23 8.5 SPBC17D11.06 |spp2|pri2|DNA primase large subunit Spp2 |Schizosa... 23 8.5 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 117 INIYCFIEKVLTINWVYIVNHYIDIIXXNSIR 22 +NI ++ L +N +Y N YI + + IR Sbjct: 660 LNISSYVNPSLGVNMLYCTNSYISLAKMSEIR 691 >SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 319 CQEDLSLQEFLEMVRSQNKIN 257 CQE ++LQE ++ +N+IN Sbjct: 488 CQEQITLQEIDDVFMGRNEIN 508 >SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 24.2 bits (50), Expect = 4.8 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 146 QWTLSLSAYSYSNKLNTLHQISYKCILLIK 235 Q+ L ++ Y+N N Q +YKC +++ Sbjct: 501 QFALPINIGGYANASNVQVQTAYKCACMLR 530 >SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 24.2 bits (50), Expect = 4.8 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +2 Query: 149 WTLSLSAYSYSNKLNTLHQISYKC 220 W +SLS+ + S +N L +++++C Sbjct: 756 WKVSLSSRAPSEAINCLSKLAFQC 779 >SPAC6F12.10c |ade3|min11|phosphoribosylformylglycinamidine synthase Ade3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 23.8 bits (49), Expect = 6.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 265 CFASEPSLKTLEGTN 309 C+ SEPSLK+ E T+ Sbjct: 196 CYTSEPSLKSREPTD 210 >SPAC1D4.04 |cct2||chaperonin-containing T-complex beta subunit Cct2|Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 23.4 bits (48), Expect = 8.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 186 LLE*EYALNDKVHCH*KRKSLVQINIYCFIEKVLTINW 73 L E E A +K+ K + + NI CFI + L NW Sbjct: 260 LAELERAEREKMKA--KVEKIKSHNINCFINRQLIYNW 295 >SPBC17D11.06 |spp2|pri2|DNA primase large subunit Spp2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 459 Score = 23.4 bits (48), Expect = 8.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 148 LSLKKKKFSTNKHLLFYRKGFNNKLGIHCEPLHRHNI 38 L LK S ++ L+F+RK F N +R+NI Sbjct: 315 LFLKDIGLSVDEALVFWRKSFTNVTEDKFNKEYRYNI 351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,041,586 Number of Sequences: 5004 Number of extensions: 16354 Number of successful extensions: 49 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 85983492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -