BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0095 (319 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) 27 3.3 SB_9039| Best HMM Match : M (HMM E-Value=0.00046) 26 5.8 >SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) Length = 910 Score = 27.1 bits (57), Expect = 3.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 151 PLSLKKKKFSTNKHLLFYRKG 89 PL + KK+FST+ +LL Y G Sbjct: 191 PLHISKKRFSTHINLLLYSHG 211 >SB_9039| Best HMM Match : M (HMM E-Value=0.00046) Length = 716 Score = 26.2 bits (55), Expect = 5.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 153 VHCH*KRKSLVQINIYCFIEKVLTINWVYIVNHYID 46 V H + +V I +YC I + I W IV Y++ Sbjct: 375 VDIHLEWTFIVDIYLYCVINVDIHIEWAIIVGIYLE 410 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,375,686 Number of Sequences: 59808 Number of extensions: 110392 Number of successful extensions: 172 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 413004273 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -