BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0094 (770 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0815 - 28269918-28270022,28270164-28270226,28270342-282704... 30 2.4 >04_04_0815 - 28269918-28270022,28270164-28270226,28270342-28270460, 28270586-28270684,28270761-28270953,28271024-28271117, 28271339-28271394,28272372-28272431,28272877-28272989, 28273286-28273343,28273429-28273521,28273659-28273904, 28274990-28275371,28275523-28275595,28275692-28275795, 28275872-28275963,28275996-28276106,28276225-28276309, 28276385-28276518,28278264-28278302 Length = 772 Score = 29.9 bits (64), Expect = 2.4 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +3 Query: 660 LLEIRWINTCGLTRRPTISNYANHNYFFRD*FLL 761 ++ +RW+N+ G R ++ +++H Y F+ FL+ Sbjct: 312 IVSLRWVNSDGKAGRLYVNGFSDHAYLFQIAFLM 345 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,095,570 Number of Sequences: 37544 Number of extensions: 292483 Number of successful extensions: 446 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -