BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0094 (770 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81096-7|CAB03163.2| 2769|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z81028-6|CAB02695.2| 2769|Caenorhabditis elegans Hypothetical pr... 28 6.4 >Z81096-7|CAB03163.2| 2769|Caenorhabditis elegans Hypothetical protein B0365.7 protein. Length = 2769 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 645 RITAHLLEIRWINTCGLTRRPTISNYANHNYFFRD 749 RI L +I W++ G + T+ AN+NY R+ Sbjct: 1764 RIRRFLFQINWLDVHGTDSQLTLFPLANYNYVLRN 1798 >Z81028-6|CAB02695.2| 2769|Caenorhabditis elegans Hypothetical protein B0365.7 protein. Length = 2769 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 645 RITAHLLEIRWINTCGLTRRPTISNYANHNYFFRD 749 RI L +I W++ G + T+ AN+NY R+ Sbjct: 1764 RIRRFLFQINWLDVHGTDSQLTLFPLANYNYVLRN 1798 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,129,761 Number of Sequences: 27780 Number of extensions: 292394 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -