BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0093 (667 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0687 + 19465594-19465780,19465994-19466022,19466731-194668... 28 7.7 >09_04_0687 + 19465594-19465780,19465994-19466022,19466731-19466803, 19467237-19467311,19467583-19467644,19467727-19467795, 19468447-19468475,19468553-19468760,19468867-19469100, 19469591-19470598 Length = 657 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 513 SCHKRSLN--CGFLNEQYEYTNQYKIHLTTCQIKSITLEGEILTDKIIILL 659 SC+ L+ N YE++ + + TC +K +T + + DK+++LL Sbjct: 79 SCYDNLLSVAAAIANSAYEFSEALQ-EMGTCLLKRVTPNKDGINDKVLLLL 128 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,726,690 Number of Sequences: 37544 Number of extensions: 236576 Number of successful extensions: 380 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -