BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0083 (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 2.2 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 2.9 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 6.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.7 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 484 LHSFTQLMCK-IIVSFLCIR*KYIKYYRILRVNIQKSC*LAKGIVR*T 624 L S ++ K ++V+FL K+IK +I + I K+C A +++ T Sbjct: 277 LESLLYMVTKLVVVTFL----KFIKKIQIFGIMITKACMSASNLIQRT 320 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 263 LRVTINIIADDPNACELL*DFRKNY 337 ++++INII DPN +L + ++Y Sbjct: 136 IKLSINIILSDPNTNKLKLNTNESY 160 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = -2 Query: 418 FFSVIQKKSFWESIGSVQLNRHSEYYKIIFTKVSQQF 308 FFS ++ K ES+ + H E + + ++ F Sbjct: 164 FFSKLKHKIVGESVIDEKAEEHKEQFTALVREIRNAF 200 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -1 Query: 554 LMYFYLMHKKLTIILHINCVNE*RLRSFFLI 462 ++YF + HKK T I N +L F++ Sbjct: 1521 MLYFVIEHKKKTSTEWIQVSNNVKLGQNFVL 1551 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,888 Number of Sequences: 336 Number of extensions: 2816 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -