BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0083 (647 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0404 + 3071412-3071464,3073572-3074970 30 1.4 03_03_0031 + 13922727-13923004,13925052-13925184,13925505-13925666 28 7.4 >11_01_0404 + 3071412-3071464,3073572-3074970 Length = 483 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = -2 Query: 415 FSVIQKKSFWESIGSVQLNR----HSEYYKIIFTKVSQQFTRIR-IIGNDIYCNTQKMQN 251 +S++QKK W++I V R + + F +++++ R+ I+G CN ++N Sbjct: 193 YSMMQKKGKWKAISKVMGERGCHVSPQQCEDKFNDLNKRYKRLTDILGRGTACNV--VEN 250 Query: 250 RTKLDGQLKSQRQDEHPAATLNMLH 176 + LD S++ E LN H Sbjct: 251 HSLLDHMDISEKMKEDARKILNSKH 275 >03_03_0031 + 13922727-13923004,13925052-13925184,13925505-13925666 Length = 190 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 14 PEFNDVTKEFTKQDFRFERRLHY-EVVILRVSI*LELSATKRSCS 145 P F+ V E K DF R LH E+ L + I L + A +CS Sbjct: 63 PAFDGVALELAKLDFELVRSLHLRELKALTLHIRLGVRAPSPTCS 107 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,430,731 Number of Sequences: 37544 Number of extensions: 259336 Number of successful extensions: 427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -