Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0083
         (647 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g33020.1 68415.m04047 leucine-rich repeat family protein cont...    28   4.7  

>At2g33020.1 68415.m04047 leucine-rich repeat family protein
           contains leucine rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611
          Length = 864

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = -3

Query: 240 WTDNSSHNGKMSIQQQH*ICSTRLIPSSKTHR-EQLRFVALNSN*IETLSITTS*CSLRS 64
           W DNS+  G +++ Q     S  L  +S      QLR++ALN N   + S+ +  C+L  
Sbjct: 70  WCDNST--GAVTVLQLRDCLSGTLKSNSSLFGFHQLRYLALNRNNFTSASLPSEFCNLNK 127

Query: 63  NR-KSCFVNSLV 31
            +  S F N  +
Sbjct: 128 LKLLSLFSNGFI 139


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,431,164
Number of Sequences: 28952
Number of extensions: 233339
Number of successful extensions: 407
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 407
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)