BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0075 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 30 0.38 SPAC8E11.09c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 3.5 SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyce... 26 4.7 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 29.9 bits (64), Expect = 0.38 Identities = 23/69 (33%), Positives = 30/69 (43%) Frame = -1 Query: 279 SPFASIGSLGVVESSSPNLSPTATVVVLLGVSGNPIGLDPAKEGR*HSTSVDEVSNITTA 100 SPFAS GS +SSPN T+T + NP L + H+TS SN + Sbjct: 215 SPFAS-GSFSPFATSSPNFLSTSTPAPPNSNNANPSTLFSSIPSSRHTTSNHFPSNSAQS 273 Query: 99 NTFEIIVSP 73 + F P Sbjct: 274 SLFSPTARP 282 >SPAC8E11.09c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 26.6 bits (56), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 423 PVKTLLPPKQTQTQCRQYRAAGHRTPHRPV 512 P + PK+ Q C Y +RTP PV Sbjct: 63 PPIAISDPKEAQNHCSSYYYIKYRTPDSPV 92 >SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 442 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 566 VTNVKPTSTVANKPGAESTVTAEPYSLQWFVNHY 667 +T++K A K GA+ +T E +QW N Y Sbjct: 150 MTDIKDVVEHAAKLGAQRLITLEELPVQWHNNPY 183 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,708,647 Number of Sequences: 5004 Number of extensions: 51766 Number of successful extensions: 121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -