BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0075 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 25 0.71 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 25 0.71 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 2.9 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 25.0 bits (52), Expect = 0.71 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +2 Query: 236 DDSTTPRLPIEANGDLELIDRLSKLPVDKQPFWFINWQALEAHRKNPQTHVQRPN 400 D+S T I G + L D++ P+D+ P W N+ + K+ + RPN Sbjct: 628 DESNTKSYEIPLYGKMTLDDKVFGFPLDR-PMWAWNFTIPNMYFKDVFIY-NRPN 680 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 25.0 bits (52), Expect = 0.71 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +2 Query: 236 DDSTTPRLPIEANGDLELIDRLSKLPVDKQPFWFINWQALEAHRKNPQTHVQRPN 400 D+S T I G + L D++ P+D+ P W N+ + K+ + RPN Sbjct: 628 DESNTKSYEIPLYGKMTLDDKVFGFPLDR-PMWAWNFTIPNMYFKDVFIY-NRPN 680 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 353 LEAHRKNPQTHVQRP 397 L H ++PQTHV P Sbjct: 325 LNVHFRSPQTHVMAP 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,613 Number of Sequences: 438 Number of extensions: 3553 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -