BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0075 (717 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01550.1 68417.m00201 no apical meristem (NAM) family protein... 28 7.1 At3g45750.1 68416.m04944 expressed protein 27 9.4 >At4g01550.1 68417.m00201 no apical meristem (NAM) family protein similar to NAC1 (GI:7716952) {Medicago truncatula}; contains Pfam PF02365 : No apical meristem (NAM) protein Length = 457 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 290 IDRLSKLPVDKQPFWFINWQALEAHRKNPQ 379 ID+ S + ++ WFI +A+E +R NP+ Sbjct: 390 IDKESSMVKTEKKSWFITEEAMERNRNNPR 419 >At3g45750.1 68416.m04944 expressed protein Length = 682 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 421 HDGIYESVRPLHVGLW 374 HDG Y P+HVG W Sbjct: 630 HDGRYNGEEPMHVGQW 645 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,518,532 Number of Sequences: 28952 Number of extensions: 290993 Number of successful extensions: 710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -