BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0073 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 4.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.2 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -3 Query: 117 QGSVRHMTMNLQLPGKVVHVENLFRDSHSFFRPFDELFL 1 Q + + T +L LPG N R P DE F+ Sbjct: 62 QNNFEYDTASLPLPGLYTKSANTIRSFTHVESPIDEKFV 100 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 366 TSGPIRCLFAYTTFASRSGSCGR 298 T+ +RC+ A +T R+ CGR Sbjct: 914 TARVVRCVCAGSTGTRRATGCGR 936 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 451 LRARDELTSPPYSKLSLSFNCHNKPAATD 365 + + ++TSP + S S NKP ++D Sbjct: 417 INPQPQITSPSNTNTSTSSTNSNKPNSSD 445 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,337 Number of Sequences: 336 Number of extensions: 3217 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -