Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0072
         (513 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizo...    26   2.9  

>SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase
           Ubp16|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 457

 Score = 26.2 bits (55), Expect = 2.9
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +2

Query: 236 RPVFVEEPANAAGLCSLLQDPRSREVGRRAPSHTARPT 349
           RP  V  P+   G  ++L +P+   V R++ S    PT
Sbjct: 30  RPAVVSSPSVPEGTYTVLNNPKQSTVSRKSFSAPTSPT 67


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,706,686
Number of Sequences: 5004
Number of extensions: 27982
Number of successful extensions: 63
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 62
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 206265012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)