BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0071 (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK127397-1|BAC86958.1| 130|Homo sapiens protein ( Homo sapiens ... 31 5.1 >AK127397-1|BAC86958.1| 130|Homo sapiens protein ( Homo sapiens cDNA FLJ45488 fis, clone BRTHA2003759. ). Length = 130 Score = 30.7 bits (66), Expect = 5.1 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 2/108 (1%) Frame = +3 Query: 39 LQHLRYYVYSILFSTYSVNS-MYSNIL*F-YIYT*IHFLHLTYELFFKHSFEE*FMC*VN 212 L+ L Y+Y ++ + +Y I + YIY I+F TY + + F ++C Sbjct: 2 LEKLYVYIYMFMYIFIFIYIFIYIYIYVYVYIYLYIYFYIFTY--IYLYIFIYIYICLYI 59 Query: 213 YIMYHLIVF*HFLISAVGYILNS*FIFHFCQIMSYPIIFVFVISSYYI 356 Y+ +L +F + I +I FI+ C I Y I+VF+ + Y+ Sbjct: 60 YLYIYLYIFTYIYIYLHIFIYLHIFIY-IC-ICLYIFIYVFIYINIYM 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,412,966 Number of Sequences: 237096 Number of extensions: 1466938 Number of successful extensions: 2032 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2031 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -