Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0066
         (537 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P22224 Cluster: Exocyst complex component SEC15; n=4; S...    32   9.6  

>UniRef50_P22224 Cluster: Exocyst complex component SEC15; n=4;
           Saccharomycetales|Rep: Exocyst complex component SEC15 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 910

 Score = 31.9 bits (69), Expect = 9.6
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +1

Query: 394 LKSQLPDYTQP-VQLYKFKFIDRSNLFLLLALIPHFVGS 507
           LK+Q  DY +P ++L K+  I + +  LLL+ I HFV S
Sbjct: 832 LKTQGKDYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSS 870


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 390,876,784
Number of Sequences: 1657284
Number of extensions: 5611163
Number of successful extensions: 11525
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11525
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 34156095254
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)