BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0066 (537 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.09c |mug184||meiotically upregulated gene Mug184|Schizo... 26 3.1 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 5.4 SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 25 7.2 >SPBC1773.09c |mug184||meiotically upregulated gene Mug184|Schizosaccharomyces pombe|chr 2|||Manual Length = 551 Score = 26.2 bits (55), Expect = 3.1 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 173 FFYFNKRLFETEASLSFKYEKKHGGSMKESRKPTRAN 283 FF F K + S SFK E + K S KP +++ Sbjct: 291 FFTFTKTEESSPYSFSFKLEDSNTPKFKSSSKPVKSS 327 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.4 bits (53), Expect = 5.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 173 FFYFNKRLFETEASLSFKYEKKHGGSMKESRKPTRAN 283 F F + E SL ++KK+ +KE++ PTR++ Sbjct: 444 FDSFVNKFSELNDSLDQFFKKKYEEEIKETKSPTRSS 480 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.0 bits (52), Expect = 7.2 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +1 Query: 379 LRDVRLKSQLPDYTQPVQLYKFKFIDRSNLFLLLALIPHFVGSS 510 +R RL S+ P+ QP++ +F+ RS + ++P G + Sbjct: 313 IRMYRLMSRTPNGLQPLRQTFEEFVKRSGFAAVAKIVPQVGGEA 356 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,725,591 Number of Sequences: 5004 Number of extensions: 26546 Number of successful extensions: 55 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -