BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0065 (635 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D8A037 Cluster: hypothetical protein eimer1508.t... 34 2.5 UniRef50_Q6CB32 Cluster: Similarity; n=2; root|Rep: Similarity -... 33 7.6 >UniRef50_UPI0000D8A037 Cluster: hypothetical protein eimer1508.tmp20; n=1; Eimeria tenella|Rep: hypothetical protein eimer1508.tmp20 - Eimeria tenella Length = 638 Score = 34.3 bits (75), Expect = 2.5 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -1 Query: 191 FLYFLVGFSIKAYFVSFFKLLFIFHFLVEFQYFFSIF 81 F +F F +F FFK FIF F + F FF IF Sbjct: 50 FFFFFFFFFFFFFFFFFFKFTFIFFFFIFFFIFFFIF 86 >UniRef50_Q6CB32 Cluster: Similarity; n=2; root|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 281 Score = 32.7 bits (71), Expect = 7.6 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 191 FLYFLVGFSIKAYFVSFFKLLFIFHFLVEFQYFF 90 F+YF+ FS +F FF +FIF F+ F + F Sbjct: 23 FIYFIFSFSYFFFFFFFFFYIFIFIFIFIFIFIF 56 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,471,861 Number of Sequences: 1657284 Number of extensions: 6033436 Number of successful extensions: 13026 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12893 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47296372782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -