BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0065 (635 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.13c |sec27||coatomer beta' subunit |Schizosaccharomyces... 26 4.0 SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo... 25 9.1 >SPBC16C6.13c |sec27||coatomer beta' subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 796 Score = 26.2 bits (55), Expect = 4.0 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +3 Query: 438 WRWLNYCCSRLI----NRTALIFSHPRFSLVLCGNE-GYVRVYILRIWYKLVK 581 W + C R++ N + F H +F +++ G+E G V+++ + Y L+K Sbjct: 213 WDYQTKACVRILEGHTNNVSFAFFHSKFPIIISGSEDGTVKIW-HTLSYSLIK 264 >SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1588 Score = 25.0 bits (52), Expect = 9.1 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 12 PLQNVGLIRNLVYLLR--TDDNAILKNRKKILK 104 PLQ V L+RNLV + D AI+ +K ++K Sbjct: 814 PLQEVSLVRNLVKTAQQWLDKFAIIFKKKSMVK 846 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,843,047 Number of Sequences: 5004 Number of extensions: 26814 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -