BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0065 (635 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0496 + 14706959-14707020,14707173-14707538,14708070-147082... 29 4.1 04_04_0451 - 25323178-25323241,25323614-25323741,25324533-253246... 28 7.1 >05_03_0496 + 14706959-14707020,14707173-14707538,14708070-14708209, 14708319-14708566,14708814-14708946,14709096-14709159, 14709284-14709380,14709505-14709607,14709702-14709838, 14710063-14710152,14710240-14710401 Length = 533 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 188 LYFLVG-FSIKAYFVSFFKLLFIFHFLVEFQYFFSIF*YC 72 ++ LVG + A+F FF F F F F +FFS YC Sbjct: 75 IFVLVGQWEGYAFFFFFFFFFFFFFFFFFFFFFFSGDVYC 114 >04_04_0451 - 25323178-25323241,25323614-25323741,25324533-25324634, 25325314-25325382,25325489-25325557,25325646-25325720, 25325805-25325909,25326394-25326492,25326626-25328344, 25328629-25328931,25329031-25329129,25329733-25329850, 25329933-25330018,25330091-25330159,25330232-25330306, 25330675-25330772,25331271-25331432,25332391-25332556, 25332902-25332970,25333064-25333126,25333221-25333376, 25334027-25334365 Length = 1410 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 486 LIFSHPRFSLVLCGNEGYVRVYILRIWY-KLVKLVTYKNLRKKQ 614 L F++ FS +EGY L++W KL LV KN + K+ Sbjct: 895 LEFANKSFSKYTVDSEGYSNSGFLKLWLSKLAPLVHEKNAKLKE 938 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,680,811 Number of Sequences: 37544 Number of extensions: 159330 Number of successful extensions: 252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -