Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0063
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p...    27   2.7  
SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizos...    26   3.6  

>SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1323

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -3

Query: 206  SFCCLKISGHCVAC 165
            +FCCL I G C+ C
Sbjct: 1266 TFCCLSIHGLCIVC 1279


>SPAC22F8.11 |plc1||phosphoinositide phospholipase C
           Plc1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 899

 Score = 26.2 bits (55), Expect = 3.6
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = -1

Query: 268 HFSTYILMKQTQNVIYSKHIQAFVVSRYPGTVSLAPKRIHC 146
           H  T+  M +  +VI +    AFVVS YP  +SL    IHC
Sbjct: 500 HGHTFTSMIKFNDVIDAIRKYAFVVSPYPLFISL---EIHC 537


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,419,341
Number of Sequences: 5004
Number of extensions: 51129
Number of successful extensions: 111
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)