BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0063 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0270 + 28048449-28048577,28048915-28048978,28049537-280496... 29 3.7 >01_06_0270 + 28048449-28048577,28048915-28048978,28049537-28049638, 28049971-28050021,28050075-28050172,28050395-28050485, 28050718-28050782,28050913-28051107,28051207-28051326, 28051592-28051662,28051787-28052012,28052330-28052407, 28052507-28052735,28052958-28053097,28053571-28053699 Length = 595 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -1 Query: 277 TNYHFSTYILMKQTQNVIYSKHIQAFVVSRYPGTVSLAPKRIHCGAAMHARTHK 116 T Y + + + + + SKH+++ + SR PG SL K I A + A H+ Sbjct: 245 TEYKYLAHRMGSEHLAKMLSKHLESVIKSRIPGIQSLISKAI---AELEAELHR 295 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,248,618 Number of Sequences: 37544 Number of extensions: 282096 Number of successful extensions: 585 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -