BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0061 (743 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 24 4.3 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 10.0 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 24.2 bits (50), Expect = 4.3 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 204 MYVVSESENYRNLINYRFDQIIV--FLSTFVSLHCKYLS 314 +Y+V +SE++ N + DQ++V F +T+ CK ++ Sbjct: 2 VYMVKDSEDFNNKLEAAGDQLVVVDFFATWCG-PCKVIA 39 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.0 bits (47), Expect = 10.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 94 FELWAYSRSTFSSFKHYVPKH 32 FELWA+S ++F + +H Sbjct: 72 FELWAHSNEGLANFHQALRQH 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,431 Number of Sequences: 2352 Number of extensions: 11555 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -