BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0060 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32398| Best HMM Match : PspC (HMM E-Value=1.4) 28 6.8 SB_19693| Best HMM Match : Sugar_tr (HMM E-Value=0.0002) 28 6.8 >SB_32398| Best HMM Match : PspC (HMM E-Value=1.4) Length = 203 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 572 LLRFSWVICPFNPLTAI*VYVI*DQSPTRCPGRVYFNFCVISI 700 L R++ + C +N T VY D T+ PG +YFN+ ++++ Sbjct: 74 LRRWTIITC-YNWFTVSLVYFGFDLYTTQLPGSIYFNYFIMNL 115 >SB_19693| Best HMM Match : Sugar_tr (HMM E-Value=0.0002) Length = 512 Score = 28.3 bits (60), Expect = 6.8 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 572 LLRFSWVICPFNPLTAI*VYVI*DQSPTRCPGRVYFNFCVISI 700 L R++ + C +N T VY D T+ PG +YFN+ ++++ Sbjct: 308 LRRWTIITC-YNWFTVSLVYFGFDLYTTQLPGSIYFNYFIMNL 349 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,902,142 Number of Sequences: 59808 Number of extensions: 329929 Number of successful extensions: 716 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -