BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0060 (733 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L17337-3|AAA28222.1| 331|Caenorhabditis elegans Hypothetical pr... 28 5.9 AF038608-10|AAC25814.2| 327|Caenorhabditis elegans Serpentine r... 28 7.8 >L17337-3|AAA28222.1| 331|Caenorhabditis elegans Hypothetical protein ZK686.3 protein. Length = 331 Score = 28.3 bits (60), Expect = 5.9 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = -3 Query: 293 SYLKIVSNYLESQSGNTFICLIYSFVQFVFYHYYRATPTIYSFDFS 156 S L I +N L + +G IC+ +SF+ VF YR P YSF F+ Sbjct: 289 SLLNIPTNTL-AIAGLVCICVFFSFLLSVFRSKYRGYP--YSFLFA 331 >AF038608-10|AAC25814.2| 327|Caenorhabditis elegans Serpentine receptor, class z protein78 protein. Length = 327 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -3 Query: 326 RTEREIDIQNESYLKIVSNYLESQSGNTFICLIYSFVQFVFYHYY 192 RT + IQN +V+NY+ Q+ FIC + V FV+ + Y Sbjct: 220 RTRKFASIQN----CVVNNYIHWQTLTVFICKSIAIVLFVYNNTY 260 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,451,992 Number of Sequences: 27780 Number of extensions: 269262 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -