BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0057 (735 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 25 0.63 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 24 1.5 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 7.8 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 25.0 bits (52), Expect = 0.63 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 313 PRHLLVMKGAPERILERCSTIFIGGKEKVLDEEMKEAFNNA 435 P+H+L+ KG PE + + + + +D+ + N+A Sbjct: 583 PQHMLIPKGTPEGMKSQLFVMISNYDDDKIDQSTEGVCNDA 623 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -2 Query: 725 LPSEIIPTDLAIALAVMGWSPVTMITLIP 639 +P+ + D+A+ L G SP+ ++ IP Sbjct: 175 VPTRLANGDIALVLPTQGASPLPLLVPIP 203 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 4.5 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = -2 Query: 218 DKTSPRASSMHFSKAASEASPATSFFRIGTPS*PPLNSARLQSEAILARALKPGLVRSY 42 +K++ R ++ AS+ASPA + + TP+ P S + + P + +SY Sbjct: 191 NKSASRTTTSPTKVKASKASPAAAPRSVATPTGIPTPSTSASPPTVNIKKESPQM-QSY 248 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = +1 Query: 247 EIPFNSTNKYQVSIHESDDPSDPRHLL 327 +I NS +KY+ ++H ++PR ++ Sbjct: 143 QIMLNSLHKYKPTVHLVRVGTEPRRVI 169 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.136 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,999 Number of Sequences: 336 Number of extensions: 2834 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -