BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0052 (664 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99288-9|CAB16551.2| 335|Caenorhabditis elegans Hypothetical pr... 31 0.55 U58756-2|AAC48083.2| 322|Caenorhabditis elegans Hypothetical pr... 30 1.3 >Z99288-9|CAB16551.2| 335|Caenorhabditis elegans Hypothetical protein ZK262.10 protein. Length = 335 Score = 31.5 bits (68), Expect = 0.55 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 82 VP*LINVKTIVITVLFL*SYHDFLHCHNGTYRSLCVY 192 +P + V +I+I +LF+ HD H H G YR L ++ Sbjct: 10 IPKIGGVFSIIINLLFIFIAHDDKHVHFGNYRFLLIF 46 >U58756-2|AAC48083.2| 322|Caenorhabditis elegans Hypothetical protein F58F9.3b protein. Length = 322 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +3 Query: 306 NEKKKSIFMSLRH--N*DYFFNGFFLLT*QRLLRYECVKVLSDI 431 ++++KSIF S H +FF G+F T ++ECVK L I Sbjct: 202 DKQEKSIFTSKTHVLGLGHFFEGYFEQTPNGKSQWECVKYLKQI 245 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,930,575 Number of Sequences: 27780 Number of extensions: 217591 Number of successful extensions: 416 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -