BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0045 (742 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071516-1|AAL49138.1| 265|Drosophila melanogaster RE56869p pro... 29 5.0 AE013599-480|AAF59207.1| 265|Drosophila melanogaster CG1406-PA ... 29 5.0 >AY071516-1|AAL49138.1| 265|Drosophila melanogaster RE56869p protein. Length = 265 Score = 29.5 bits (63), Expect = 5.0 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -2 Query: 579 LSYRGFRFSLIEVLGAKNDG-SWLLLSLIEFSHLSS-SHLPRFDCICINHN 433 L RG++ IE LGA D + LS + L + HLPR C+ +N+N Sbjct: 24 LDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNN 74 >AE013599-480|AAF59207.1| 265|Drosophila melanogaster CG1406-PA protein. Length = 265 Score = 29.5 bits (63), Expect = 5.0 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -2 Query: 579 LSYRGFRFSLIEVLGAKNDG-SWLLLSLIEFSHLSS-SHLPRFDCICINHN 433 L RG++ IE LGA D + LS + L + HLPR C+ +N+N Sbjct: 24 LDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNN 74 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,856,553 Number of Sequences: 53049 Number of extensions: 469679 Number of successful extensions: 970 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 970 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3355404063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -