BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0045 (742 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g14760.1 68414.m01764 expressed protein 28 7.5 At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative... 27 9.9 >At1g14760.1 68414.m01764 expressed protein Length = 142 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -3 Query: 131 FRILLFFFPCFSIFI*TRTN*DSFLFCFKFQIN 33 F +L FF PC +IF +T LF F QIN Sbjct: 96 FMVLFFFSPCQNIFTQQKTTFHVLLF-FPLQIN 127 >At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative strong similarity to gi:4467359 Length = 1116 Score = 27.5 bits (58), Expect = 9.9 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +2 Query: 584 FFPS*TSVSETATILYLYKRQSSFIYLY-----YLGGTNDKTNYKFKICYFMTH 730 FF S + E + YLYK Q S + Y Y + +Y F+ICY M H Sbjct: 40 FFDS-SFFCEWIAVSYLYKHQHSGVRDYLCNRMYTLPLSGIESYLFQICYLMVH 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,872,455 Number of Sequences: 28952 Number of extensions: 237159 Number of successful extensions: 488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -