BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0044 (794 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3815|AAF47164.2| 2291|Drosophila melanogaster CG11290-P... 37 0.036 >AE013599-3815|AAF47164.2| 2291|Drosophila melanogaster CG11290-PA protein. Length = 2291 Score = 36.7 bits (81), Expect = 0.036 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +2 Query: 296 ILAAIDHLRARKSRPDANRICKFMLKCYKVQPKDTKADLKRCLKEKSIYKVDYKDNVSYR 475 IL AI +R++K RP RIC+ + +K L++ ++ ++ KV K SY+ Sbjct: 18 ILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAVESGAVIKVYNKGLHSYK 77 Query: 476 -NAAKWRKKSKNNT 514 AK R K NT Sbjct: 78 APMAKRRVKVDKNT 91 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,945,370 Number of Sequences: 53049 Number of extensions: 581085 Number of successful extensions: 1635 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1635 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3695805360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -