BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0043 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse tr... 23 2.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.7 >DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse transcriptase protein. Length = 42 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = -2 Query: 613 VKSKRSSFGDYFYVQHLCRNLILYEKKKNSFSMATV 506 ++S + FG YF L +++ + K N+F ++ V Sbjct: 7 LQSLKKDFGTYFQQYCLHHKILIKKNKCNAFIVSNV 42 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -1 Query: 131 YVIESSDYYIIYHSYLYETNSQTVN 57 Y+++ S Y S+LY+++ + N Sbjct: 948 YIVDESSSSSFYSSFLYKSSESSCN 972 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,488 Number of Sequences: 438 Number of extensions: 3118 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -