BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0041 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 24 3.9 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 24 5.2 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 303 SFVLISEQQGLIYWLYKVHLIKLIYYDRNLFD 208 + VL S + L W V +K IY+ NLF+ Sbjct: 283 AIVLASVAKELFSWRIMVKKMKAIYHTLNLFN 314 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 483 HGTLEYSLCDKKNHGVISFNGFYVASR 403 HG SLC + ++SF FY+A + Sbjct: 250 HGLFNVSLCQYDSPILLSFPHFYLADQ 276 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,443 Number of Sequences: 2352 Number of extensions: 12648 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -