BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0038 (785 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_1049 + 22015053-22015083,22015770-22015885,22016013-220161... 28 9.7 >04_03_1049 + 22015053-22015083,22015770-22015885,22016013-22016108, 22016229-22016285,22016468-22016620,22016754-22016838, 22017097-22017187,22017324-22017488,22017813-22017932, 22018020-22018104,22018234-22018402,22019055-22019173, 22019250-22019440,22019746-22019957,22020905-22021500, 22022538-22022658,22023439-22023868,22024412-22024797, 22024976-22025071,22025380-22025432,22026915-22027061, 22027139-22027309,22027880-22027962,22028049-22028247, 22028668-22028789,22029752-22029818,22029960-22030010, 22030768-22031001,22031263-22031451,22032455-22032646, 22032742-22032936 Length = 1673 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 593 ECLIIFSLSCSKKKTLRYCLDVLSLPYYHYYYF 691 EC I S KK +RYCL +L + Y ++F Sbjct: 1562 ECHIDISAKIPTKKDIRYCLIMLFVQGYKDWFF 1594 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,147,420 Number of Sequences: 37544 Number of extensions: 275508 Number of successful extensions: 420 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -