BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0038 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding pr... 25 3.5 AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding pr... 25 3.5 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 8.1 >AY146747-1|AAO12062.1| 288|Anopheles gambiae odorant-binding protein AgamOBP42 protein. Length = 288 Score = 24.6 bits (51), Expect = 3.5 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 590 MECLIIFSLSCSK-KKTLRYCLDVLSLPY 673 + C + LS + +T+ +CLDVL +P+ Sbjct: 140 LNCPKVVPLSDERLTETMHFCLDVLDIPF 168 >AJ618931-1|CAF02009.1| 288|Anopheles gambiae odorant-binding protein OBPjj83d protein. Length = 288 Score = 24.6 bits (51), Expect = 3.5 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 590 MECLIIFSLSCSK-KKTLRYCLDVLSLPY 673 + C + LS + +T+ +CLDVL +P+ Sbjct: 140 LNCPKVVPLSDERLTETMHFCLDVLDIPF 168 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 605 IFSLSCSKKKTLRYCLDVLSLPYYHYYYFNILHI 706 +FS+S S K + L H+Y+ N+L + Sbjct: 217 VFSISTSNGKGVVRLARALDYERQHFYHINVLAV 250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,911 Number of Sequences: 2352 Number of extensions: 14109 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -