BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0034 (684 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9VMC4 Cluster: CG9550-PA; n=3; Sophophora|Rep: CG9550-... 35 2.1 UniRef50_Q6HHW5 Cluster: Acyltransferase family protein; n=1; Ba... 33 8.6 >UniRef50_Q9VMC4 Cluster: CG9550-PA; n=3; Sophophora|Rep: CG9550-PA - Drosophila melanogaster (Fruit fly) Length = 363 Score = 34.7 bits (76), Expect = 2.1 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 324 NCIHVRGCFQHYIPLIYFKSKSLSKIE 404 N H GC+QHY PLI ++S+S++ E Sbjct: 84 NLAHQPGCYQHYAPLIAYESRSIAAKE 110 >UniRef50_Q6HHW5 Cluster: Acyltransferase family protein; n=1; Bacillus thuringiensis serovar konkukian|Rep: Acyltransferase family protein - Bacillus thuringiensis subsp. konkukian Length = 389 Score = 32.7 bits (71), Expect = 8.6 Identities = 18/37 (48%), Positives = 24/37 (64%) Frame = -1 Query: 426 TLILNFILLSSKVILT*NKLGVYNVESTLLHEYNLFL 316 TLI++FI SS +LT NKL V+N L+ Y LF+ Sbjct: 186 TLIVSFIWCSSAFVLT-NKLNVFNQSDYLMTIYYLFM 221 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,385,366 Number of Sequences: 1657284 Number of extensions: 7808623 Number of successful extensions: 12258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12256 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -