BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0029 (630 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 6.8 SPAC1783.03 |fta2|sma2|Sim4 and Mal2 associated |Schizosaccharom... 25 9.0 >SPAC1565.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 773 Score = 25.4 bits (53), Expect = 6.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 359 FKTLNKILISNALRFK*INLLYYTYCMKYII 451 FKTL +++ + L NL Y YC+ ++ Sbjct: 629 FKTLGNLVVDSNLASVKFNLETYIYCLSVVL 659 >SPAC1783.03 |fta2|sma2|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 1|||Manual Length = 351 Score = 25.0 bits (52), Expect = 9.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +2 Query: 374 KILISNALRFK*INLLYYTYCMKYIIRK*NKIISHVT 484 KI I ++F + + YC+ YI++ N+ I +T Sbjct: 278 KITILYEIKFDDLGFVQPNYCISYILKNQNEKIVSIT 314 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,121,466 Number of Sequences: 5004 Number of extensions: 37767 Number of successful extensions: 56 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -