BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0029 (630 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_41711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2214 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 139 YVFFCEFSIFSCCV*-LFQFKNTTSLYFWIIKPYQ*QGYVLKKNYCYLFISIL 294 YV ++S + LF + + W P++ Y++ +NY +L I +L Sbjct: 2135 YVLMYRTPLYSAYILVLFVTSRPATSFLWFTSPFKTLKYIIWRNYKWLIIGLL 2187 >SB_41711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1662 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 529 VLIVKGPNLNTVFVSSHMTDDFVSFSDNVFHTISIIQ 419 V+I KG V SH T+ F+D +FHT S+ + Sbjct: 1210 VVIAKGA---AKMVLSHKTEQAGVFNDTIFHTFSVAE 1243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,483,324 Number of Sequences: 59808 Number of extensions: 234317 Number of successful extensions: 284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -