BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0029 (630 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21323-12|AAA62554.2| 354|Caenorhabditis elegans Hypothetical p... 29 2.7 Z81076-2|CAB03051.3| 333|Caenorhabditis elegans Hypothetical pr... 28 4.8 >U21323-12|AAA62554.2| 354|Caenorhabditis elegans Hypothetical protein C45G9.11 protein. Length = 354 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 97 NIIYTFCL*SFFFNYVFFCEFSIFS 171 +I Y FC+ SFF N+ FF FSI+S Sbjct: 278 HIHYIFCIFSFFINF-FFLIFSIWS 301 >Z81076-2|CAB03051.3| 333|Caenorhabditis elegans Hypothetical protein F35C5.2 protein. Length = 333 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 371 NKILISNALRFK*INL-LYYTYCMKYIIRK*NKIISHVTRHK 493 N I+ A+ + + L L +C++Y+ R+ + I H+T HK Sbjct: 277 NLIIWVYAISYATVTLPLLIIFCIRYVRRRRQRTIHHITSHK 318 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,506,067 Number of Sequences: 27780 Number of extensions: 206203 Number of successful extensions: 306 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 306 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -