BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0029 (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 1.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.3 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/42 (23%), Positives = 22/42 (52%) Frame = +1 Query: 379 TYFKCIKV*ID*SIVLYLLYEIHYPKMKQNHQSCDSTQILYL 504 TYF CI + S+V +L ++ + H+ + ++++L Sbjct: 296 TYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWVKVVFL 337 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 21 KHSILFILNKTYMPTCLLL 77 K + + L TY+PTCL++ Sbjct: 241 KRRLGYYLFHTYIPTCLIV 259 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,011 Number of Sequences: 438 Number of extensions: 2758 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -